Lineage for d1gcva_ (1gcv A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436191Protein Hemoglobin, alpha-chain [46486] (18 species)
  7. 436248Species Houndshark (Mustelus griseus) [TaxId:89020] [46499] (2 PDB entries)
  8. 436249Domain d1gcva_: 1gcv A: [15410]
    Other proteins in same PDB: d1gcvb_, d1gcvd_

Details for d1gcva_

PDB Entry: 1gcv (more details), 2 Å

PDB Description: deoxy form hemoglobin from mustelus griseus

SCOP Domain Sequences for d1gcva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcva_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Houndshark (Mustelus griseus)}
aftacekqtigkiaqvlakspeaygaeclarlfvthpgsksyfeykdysaagakvqvhgg
kviravvkaaehvddlhshletlalthgkkllvdpqnfpmlseciivtlathltefspdt
hcavdkllsaicqelssryr

SCOP Domain Coordinates for d1gcva_:

Click to download the PDB-style file with coordinates for d1gcva_.
(The format of our PDB-style files is described here.)

Timeline for d1gcva_: