Lineage for d1spga_ (1spg A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1074991Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1075231Protein Hemoglobin, alpha-chain [46486] (22 species)
  7. 1075316Species Fish (Leiostomus xanthurus) [TaxId:59837] [46498] (1 PDB entry)
  8. 1075317Domain d1spga_: 1spg A: [15409]
    Other proteins in same PDB: d1spgb_
    complexed with cmo, hem

Details for d1spga_

PDB Entry: 1spg (more details), 1.95 Å

PDB Description: carbonmonoxy hemoglobin from the teleost fish leiostomus xanthurus
PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d1spga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1spga_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Fish (Leiostomus xanthurus) [TaxId: 59837]}
slsatdkarvkalwdkiegksaelgaealgrmlvsfpqtkiyfsewgqdlgpqtpqvrnh
gavimaavgkavksidnlvgglsqlselhafklrvdpanfkilahniilvismyfpgdft
pevhlsvdkflaclalalsekyr

SCOPe Domain Coordinates for d1spga_:

Click to download the PDB-style file with coordinates for d1spga_.
(The format of our PDB-style files is described here.)

Timeline for d1spga_: