Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (22 species) |
Species Fish (Leiostomus xanthurus) [TaxId:59837] [46498] (1 PDB entry) |
Domain d1spga_: 1spg A: [15409] Other proteins in same PDB: d1spgb_ complexed with cmo, hem |
PDB Entry: 1spg (more details), 1.95 Å
SCOPe Domain Sequences for d1spga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1spga_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Fish (Leiostomus xanthurus) [TaxId: 59837]} slsatdkarvkalwdkiegksaelgaealgrmlvsfpqtkiyfsewgqdlgpqtpqvrnh gavimaavgkavksidnlvgglsqlselhafklrvdpanfkilahniilvismyfpgdft pevhlsvdkflaclalalsekyr
Timeline for d1spga_: