SCOPe 2.01: Domain d1spga_: 1spg A:

Lineage for d1spga_ (1spg A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (22 species)

7. Species Fish (Leiostomus xanthurus) [TaxId:59837] [46498] (1 PDB entry)

8. Domain d1spga_: 1spg A: [15409]
   Other proteins in same PDB: d1spgb_
   complexed with cmo, hem

Details for d1spga_

PDB Entry: 1spg, 1.95 Å

PDB Description: carbonmonoxy hemoglobin from the teleost fish leiostomus xanthurus

PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d1spga_:

Sequence; same for both SEQRES and ATOM records:

>d1spga_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Fish (Leiostomus xanthurus) [TaxId: 59837]}
slsatdkarvkalwdkiegksaelgaealgrmlvsfpqtkiyfsewgqdlgpqtpqvrnh
gavimaavgkavksidnlvgglsqlselhafklrvdpanfkilahniilvismyfpgdft
pevhlsvdkflaclalalsekyr

Timeline for d1spga_:

• d1spga_ first appeared (with stable ids) in SCOP 1.55
  
• d1spga_ appears in SCOP 1.75
  
• d1spga_ appears in SCOPe 2.02
  
• d1spga_ appears in the current release, SCOPe 2.08