SCOP 1.55: Domain d1spga_: 1spg A:

Lineage for d1spga_ (1spg A:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (16 proteins)

6. Protein Hemoglobin, alpha-chain [46486] (13 species)

7. Species Teleost fish (Leiostomus xanthurus) [46498] (1 PDB entry)

8. Domain d1spga_: 1spg A: [15409]
   Other proteins in same PDB: d1spgb_

Details for d1spga_

PDB Entry: 1spg, 1.95 Å

PDB Description: carbonmonoxy hemoglobin from the teleost fish leiostomus xanthurus

SCOP Domain Sequences for d1spga_:

Sequence; same for both SEQRES and ATOM records:

>d1spga_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Teleost fish (Leiostomus xanthurus)}
slsatdkarvkalwdkiegksaelgaealgrmlvsfpqtkiyfsewgqdlgpqtpqvrnh
gavimaavgkavksidnlvgglsqlselhafklrvdpanfkilahniilvismyfpgdft
pevhlsvdkflaclalalsekyr

Timeline for d1spga_:

• d1spga_ appears in SCOP 1.57
  
• d1spga_ appears in the current release, SCOPe 2.08