Lineage for d2z4li1 (2z4l I:73-141)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480444Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 1480445Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 1480446Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 1480464Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
    Uniprot P0A7J7 73-141
  8. 1480487Domain d2z4li1: 2z4l I:73-141 [154086]
    Other proteins in same PDB: d2z4l01, d2z4l11, d2z4l31, d2z4l41, d2z4l61, d2z4lc1, d2z4lc2, d2z4ld1, d2z4le1, d2z4lf1, d2z4lg1, d2z4lg2, d2z4lh1, d2z4lh2, d2z4li2, d2z4lj1, d2z4lk1, d2z4ll1, d2z4lm1, d2z4ln1, d2z4lo1, d2z4lp1, d2z4lq1, d2z4lr1, d2z4ls1, d2z4lt1, d2z4lu1, d2z4lv1, d2z4lw1, d2z4lx1, d2z4ly1, d2z4lz1
    automatically matched to 2AW4 I:73-141
    protein/RNA complex; complexed with mg, par, zn

Details for d2z4li1

PDB Entry: 2z4l (more details), 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 50S subunit of the first 70S ribosome, with paromomycin and RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2z4li1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z4li1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

SCOPe Domain Coordinates for d2z4li1:

Click to download the PDB-style file with coordinates for d2z4li1.
(The format of our PDB-style files is described here.)

Timeline for d2z4li1: