![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.77: RL5-like [55281] (1 superfamily) beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654 |
![]() | Superfamily d.77.1: RL5-like [55282] (3 families) ![]() |
![]() | Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein) |
![]() | Protein Ribosomal protein L5 [55284] (5 species) synonym: 50S ribosomal protein L5p, HMAL5, HL13 |
![]() | Species Escherichia coli [TaxId:562] [160488] (29 PDB entries) Uniprot P62399 1-178 |
![]() | Domain d2z4lf1: 2z4l F:1-178 [154081] Other proteins in same PDB: d2z4l01, d2z4l11, d2z4l31, d2z4l41, d2z4l61, d2z4lc1, d2z4lc2, d2z4ld1, d2z4le1, d2z4lg1, d2z4lg2, d2z4lh1, d2z4lh2, d2z4li1, d2z4li2, d2z4lj1, d2z4lk1, d2z4ll1, d2z4lm1, d2z4ln1, d2z4lo1, d2z4lp1, d2z4lq1, d2z4lr1, d2z4ls1, d2z4lt1, d2z4lu1, d2z4lv1, d2z4lw1, d2z4lx1, d2z4ly1, d2z4lz1 automatically matched to 2AW4 F:1-178 protein/RNA complex; complexed with mg, par, zn |
PDB Entry: 2z4l (more details), 4.45 Å
SCOPe Domain Sequences for d2z4lf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z4lf1 d.77.1.1 (F:1-178) Ribosomal protein L5 {Escherichia coli [TaxId: 562]} aklhdyykdevvkklmtefnynsvmqvprvekitlnmgvgeaiadkklldnaaadlaais gqkplitkarksvagfkirqgypigckvtlrgermwefferlitiavprirdfrglsaks fdgrgnysmgvreqiifpeidydkvdrvrgldititttaksdeegrallaafdfpfrk
Timeline for d2z4lf1:
![]() Domains from other chains: (mouse over for more information) d2z4l01, d2z4l11, d2z4l31, d2z4l41, d2z4l61, d2z4lc1, d2z4lc2, d2z4ld1, d2z4le1, d2z4lg1, d2z4lg2, d2z4lh1, d2z4lh2, d2z4li1, d2z4li2, d2z4lj1, d2z4lk1, d2z4ll1, d2z4lm1, d2z4ln1, d2z4lo1, d2z4lp1, d2z4lq1, d2z4lr1, d2z4ls1, d2z4lt1, d2z4lu1, d2z4lv1, d2z4lw1, d2z4lx1, d2z4ly1, d2z4lz1 |