Lineage for d1t1na_ (1t1n A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1976759Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 1976764Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46497] (7 PDB entries)
  8. 1976771Domain d1t1na_: 1t1n A: [15408]
    Other proteins in same PDB: d1t1nb_
    complexed with cmo, hem

Details for d1t1na_

PDB Entry: 1t1n (more details), 2.2 Å

PDB Description: crystal structure of carbonmonoxy hemoglobin
PDB Compounds: (A:) protein (hemoglobin)

SCOPe Domain Sequences for d1t1na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1na_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOPe Domain Coordinates for d1t1na_:

Click to download the PDB-style file with coordinates for d1t1na_.
(The format of our PDB-style files is described here.)

Timeline for d1t1na_: