SCOPe 2.03: Domain d2z4ku1: 2z4k U:3-53

Lineage for d2z4ku1 (2z4k U:3-53)

1. Root: SCOPe 2.03

2. Class j: Peptides [58231] (120 folds)

3. Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family)

5. Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
   Pfam PF01165

6. Protein Ribosomal protein S21, RpsU [161310] (1 species)

7. Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
   Uniprot P68679 4-54

8. Domain d2z4ku1: 2z4k U:3-53 [154071]
   Other proteins in same PDB: d2z4kb1, d2z4kc1, d2z4kc2, d2z4kd1, d2z4ke1, d2z4ke2, d2z4kf1, d2z4kg1, d2z4kh1, d2z4ki1, d2z4kj1, d2z4kk1, d2z4kl1, d2z4km1, d2z4kn1, d2z4kp1, d2z4kq1, d2z4kr1, d2z4ks1, d2z4kt1
   automatically matched to 2AVY U:3-53
   protein/RNA complex; complexed with mg, par

Details for d2z4ku1

PDB Entry: 2z4k, 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d2z4ku1:

Sequence; same for both SEQRES and ATOM records:

>d2z4ku1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

Timeline for d2z4ku1:

• d2z4ku1 first appeared in SCOP 1.75
  
• d2z4ku1 appears in SCOPe 2.02
  
• d2z4ku1 appears in SCOPe 2.04
  
• d2z4ku1 appears in the current release, SCOPe 2.08