Lineage for d1cg8a_ (1cg8 A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 148222Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 148223Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 148233Family a.1.1.2: Globins [46463] (18 proteins)
  6. 148338Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 148353Species Cartilaginous fish akaei (Dasyatis akajei) [TaxId:31902] [46496] (2 PDB entries)
  8. 148355Domain d1cg8a_: 1cg8 A: [15407]
    Other proteins in same PDB: d1cg8b_

Details for d1cg8a_

PDB Entry: 1cg8 (more details), 1.9 Å

PDB Description: CO Form Hemoglobin from Dasyatis Akajei

SCOP Domain Sequences for d1cg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cg8a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei)}
vlssqnkkaieelgnlikanaeawgadalarlfelhpqtktyfskfsgfeacneqvkkhg
krvmnaladathhldnlhlhledlarkhgenllvdphnfhlfadcivvtlavnlqaftpv
thcavdkflelvayelsscyr

SCOP Domain Coordinates for d1cg8a_:

Click to download the PDB-style file with coordinates for d1cg8a_.
(The format of our PDB-style files is described here.)

Timeline for d1cg8a_: