Lineage for d1cg8a_ (1cg8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686270Species Cartilaginous fish akaei (Dasyatis akajei) [TaxId:31902] [46496] (2 PDB entries)
  8. 2686272Domain d1cg8a_: 1cg8 A: [15407]
    Other proteins in same PDB: d1cg8b_
    complexed with cmo, hem

Details for d1cg8a_

PDB Entry: 1cg8 (more details), 1.9 Å

PDB Description: CO Form Hemoglobin from Dasyatis Akajei
PDB Compounds: (A:) protein (hemoglobin)

SCOPe Domain Sequences for d1cg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cg8a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}
vlssqnkkaieelgnlikanaeawgadalarlfelhpqtktyfskfsgfeacneqvkkhg
krvmnaladathhldnlhlhledlarkhgenllvdphnfhlfadcivvtlavnlqaftpv
thcavdkflelvayelsscyr

SCOPe Domain Coordinates for d1cg8a_:

Click to download the PDB-style file with coordinates for d1cg8a_.
(The format of our PDB-style files is described here.)

Timeline for d1cg8a_: