Lineage for d2z4kn1 (2z4k N:1-100)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262247Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2262248Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2262561Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 2262562Protein Ribosomal protein S14 [57753] (2 species)
  7. 2262563Species Escherichia coli [TaxId:562] [161162] (24 PDB entries)
    Uniprot P02370 1-100
  8. 2262586Domain d2z4kn1: 2z4k N:1-100 [154065]
    Other proteins in same PDB: d2z4kb1, d2z4kc1, d2z4kc2, d2z4kd1, d2z4ke1, d2z4ke2, d2z4kf1, d2z4kg1, d2z4kh1, d2z4ki1, d2z4kj1, d2z4kk1, d2z4kl1, d2z4km1, d2z4kp1, d2z4kq1, d2z4kr1, d2z4ks1, d2z4kt1, d2z4ku1
    protein/RNA complex; complexed with mg, par
    protein/RNA complex; complexed with mg, par

Details for d2z4kn1

PDB Entry: 2z4k (more details), 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2z4kn1:

Sequence, based on SEQRES records: (download)

>d2z4kn1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr
nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw

Sequence, based on observed residues (ATOM records): (download)

>d2z4kn1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr
qtgrphgflrkfglsrikvreaamrgeipglkkasw

SCOPe Domain Coordinates for d2z4kn1:

Click to download the PDB-style file with coordinates for d2z4kn1.
(The format of our PDB-style files is described here.)

Timeline for d2z4kn1: