Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (20 species) |
Species Cartilaginous fish akaei (Dasyatis akajei) [TaxId:31902] [46496] (2 PDB entries) |
Domain d1cg5a_: 1cg5 A: [15406] Other proteins in same PDB: d1cg5b_ complexed with hem |
PDB Entry: 1cg5 (more details), 1.6 Å
SCOP Domain Sequences for d1cg5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cg5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]} vlssqnkkaieelgnlikanaeawgadalarlfelhpqtktyfskfsgfeacneqvkkhg krvmnaladathhldnlhlhledlarkhgenllvdphnfhlfadcivvtlavnlqaftpv thcavdkflelvayelsscyr
Timeline for d1cg5a_: