![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) ![]() |
![]() | Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
![]() | Protein Ribosomal protein S6 [54997] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [160317] (24 PDB entries) Uniprot P02358 1-100 |
![]() | Domain d2z4kf1: 2z4k F:1-100 [154057] Other proteins in same PDB: d2z4kb1, d2z4kc1, d2z4kc2, d2z4kd1, d2z4ke1, d2z4ke2, d2z4kg1, d2z4kh1, d2z4ki1, d2z4kj1, d2z4kk1, d2z4kl1, d2z4km1, d2z4kn1, d2z4kp1, d2z4kq1, d2z4kr1, d2z4ks1, d2z4kt1, d2z4ku1 automatically matched to 2AVY F:1-100 complexed with mg, par |
PDB Entry: 2z4k (more details), 4.45 Å
SCOP Domain Sequences for d2z4kf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z4kf1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]} mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv lmnveapqevidelettfrfndavirsmvmrtkhavteas
Timeline for d2z4kf1: