SCOPe 2.04: Domain d2z4kd1: 2z4k D:1-205

Lineage for d2z4kd1 (2z4k D:1-205)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
   alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta

4. Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families)
   common motif in otherwise different folds

5. Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
   has a RRF/tRNA synthetase additional domain-like fold

6. Protein Ribosomal protein S4 [55179] (3 species)
   also contains a Zn-binding N-terminal subdomain

7. Species Escherichia coli [TaxId:562] [160439] (26 PDB entries)
   Uniprot P0A7V8 1-205

8. Domain d2z4kd1: 2z4k D:1-205 [154054]
   Other proteins in same PDB: d2z4kb1, d2z4kc1, d2z4kc2, d2z4ke1, d2z4ke2, d2z4kf1, d2z4kg1, d2z4kh1, d2z4ki1, d2z4kj1, d2z4kk1, d2z4kl1, d2z4km1, d2z4kn1, d2z4kp1, d2z4kq1, d2z4kr1, d2z4ks1, d2z4kt1, d2z4ku1
   automatically matched to 2AVY D:1-205
   protein/RNA complex; complexed with mg, par

Details for d2z4kd1

PDB Entry: 2z4k, 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d2z4kd1:

Sequence; same for both SEQRES and ATOM records:

>d2z4kd1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]}
arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv
rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk
aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt
fkrkpersdlsadinehlivelysk

Timeline for d2z4kd1:

• d2z4kd1 first appeared in SCOP 1.75
  
• d2z4kd1 appears in SCOPe 2.03
  
• d2z4kd1 appears in SCOPe 2.05
  
• d2z4kd1 appears in the current release, SCOPe 2.08