SCOPe 2.03: Domain d1hbhc_: 1hbh C:

Lineage for d1hbhc_ (1hbh C:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (23 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (11 PDB entries)

8. Domain d1hbhc_: 1hbh C: [15405]
   Other proteins in same PDB: d1hbhb_, d1hbhd_
   complexed with hem

Details for d1hbhc_

PDB Entry: 1hbh, 2.2 Å

PDB Description: structure of deoxyhaemoglobin of the antarctic fish pagothenia bernacchii and structural basis of the root effect

PDB Compounds: (C:) hemoglobin (deoxy) (alpha chain)

SCOPe Domain Sequences for d1hbhc_:

Sequence; same for both SEQRES and ATOM records:

>d1hbhc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

Timeline for d1hbhc_:

• d1hbhc_ first appeared (with stable ids) in SCOP 1.55
  
• d1hbhc_ appears in SCOPe 2.02
  
• d1hbhc_ appears in SCOPe 2.04
  
• d1hbhc_ appears in the current release, SCOPe 2.08