![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (18 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (16 species) |
![]() | Species Antarctic fish (Pagothenia bernacchii) [46495] (2 PDB entries) |
![]() | Domain d1hbhc_: 1hbh C: [15405] Other proteins in same PDB: d1hbhb_, d1hbhd_ complexed with hem |
PDB Entry: 1hbh (more details), 2.2 Å
SCOP Domain Sequences for d1hbhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hbhc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Antarctic fish (Pagothenia bernacchii)} slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp eahvsldkflsgvalalaeryr
Timeline for d1hbhc_: