![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
![]() | Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
![]() | Protein Hemolytic lectin CEL-III, domains 1 and 2 [110211] (1 species) |
![]() | Species Cucumaria echinata [TaxId:40245] [110212] (4 PDB entries) Uniprot Q868M7 11-442 |
![]() | Domain d2z49b1: 2z49 B:2-150 [154045] Other proteins in same PDB: d2z49a3, d2z49b3 automated match to d1vcla1 complexed with amg, ca, mg |
PDB Entry: 2z49 (more details), 1.95 Å
SCOPe Domain Sequences for d2z49b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z49b1 b.42.2.1 (B:2-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} vlctnpldigelrsfkskqcvdivgnqgsgniatydcdglsdqqiiicgdgtirnearny cftpdgsgnanvmsspctlypeipssqrwrqgrrktftdnggieqvateiinlasgkcld iegsdgtgdigvydcqnlddqyfyvrsrg
Timeline for d2z49b1: