SCOPe 2.08: Domain d2z49b1: 2z49 B:2-150

Lineage for d2z49b1 (2z49 B:2-150)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Hemolytic lectin CEL-III, domains 1 and 2 [110211] (1 species)

7. Species Cucumaria echinata [TaxId:40245] [110212] (4 PDB entries)
   Uniprot Q868M7 11-442

8. Domain d2z49b1: 2z49 B:2-150 [154045]
   Other proteins in same PDB: d2z49a3, d2z49b3
   automated match to d1vcla1
   complexed with amg, ca, mg

Details for d2z49b1

PDB Entry: 2z49, 1.95 Å

PDB Description: crystal structure of hemolytic lectin cel-iii complexed with methyl- alpha-d-galactopylanoside

PDB Compounds: (B:) hemolytic lectin CEL-III

SCOPe Domain Sequences for d2z49b1:

Sequence; same for both SEQRES and ATOM records:

>d2z49b1 b.42.2.1 (B:2-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]}
vlctnpldigelrsfkskqcvdivgnqgsgniatydcdglsdqqiiicgdgtirnearny
cftpdgsgnanvmsspctlypeipssqrwrqgrrktftdnggieqvateiinlasgkcld
iegsdgtgdigvydcqnlddqyfyvrsrg

Timeline for d2z49b1:

• d2z49b1 first appeared in SCOP 1.75
  
• d2z49b1 appears in SCOPe 2.07