Lineage for d2z49a3 (2z49 A:284-432)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009628Fold d.281: Hemolytic lectin CEL-III, C-terminal domain [111264] (1 superfamily)
    unusual fold
  4. 3009629Superfamily d.281.1: Hemolytic lectin CEL-III, C-terminal domain [111265] (1 family) (S)
  5. 3009630Family d.281.1.1: Hemolytic lectin CEL-III, C-terminal domain [111266] (1 protein)
  6. 3009631Protein Hemolytic lectin CEL-III, C-terminal domain [111267] (1 species)
  7. 3009632Species Cucumaria echinata [TaxId:40245] [111268] (4 PDB entries)
    Uniprot Q868M7 11-442
  8. 3009635Domain d2z49a3: 2z49 A:284-432 [154044]
    Other proteins in same PDB: d2z49a1, d2z49a2, d2z49b1, d2z49b2
    automated match to d1vcla3
    complexed with amg, ca, mg

Details for d2z49a3

PDB Entry: 2z49 (more details), 1.95 Å

PDB Description: crystal structure of hemolytic lectin cel-iii complexed with methyl- alpha-d-galactopylanoside
PDB Compounds: (A:) hemolytic lectin CEL-III

SCOPe Domain Sequences for d2z49a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z49a3 d.281.1.1 (A:284-432) Hemolytic lectin CEL-III, C-terminal domain {Cucumaria echinata [TaxId: 40245]}
ddwevptatwnmvgcdqngkvsqqisntisfsstvtagvavevsstiekgvifakatvsv
kvtaslskawtnsqsgttaitytcdnydsdeeftrgcmwqlaiettevksgdllvwnpqi
vkctrsntapgcapftkcanedctfctdi

SCOPe Domain Coordinates for d2z49a3:

Click to download the PDB-style file with coordinates for d2z49a3.
(The format of our PDB-style files is described here.)

Timeline for d2z49a3: