SCOP 1.69: Domain d1hbha_: 1hbh A:

Lineage for d1hbha_ (1hbh A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (22 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (18 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (4 PDB entries)

8. Domain d1hbha_: 1hbh A: [15404]
   Other proteins in same PDB: d1hbhb_, d1hbhd_

Details for d1hbha_

PDB Entry: 1hbh, 2.2 Å

PDB Description: structure of deoxyhaemoglobin of the antarctic fish pagothenia bernacchii and structural basis of the root effect

SCOP Domain Sequences for d1hbha_:

Sequence; same for both SEQRES and ATOM records:

>d1hbha_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii)}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

Timeline for d1hbha_:

• d1hbha_ first appeared (with stable ids) in SCOP 1.55
  
• d1hbha_ appears in SCOP 1.67
  
• d1hbha_ appears in SCOP 1.71
  
• d1hbha_ appears in the current release, SCOPe 2.08