Lineage for d1hbha_ (1hbh A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 94Protein Hemoglobin, alpha-chain [46486] (13 species)
  7. 95Species Antarctic fish (Pagothenia bernacchii) [46495] (2 PDB entries)
  8. 97Domain d1hbha_: 1hbh A: [15404]
    Other proteins in same PDB: d1hbhb_, d1hbhd_

Details for d1hbha_

PDB Entry: 1hbh (more details), 2.2 Å

PDB Description: structure of deoxyhaemoglobin of the antarctic fish pagothenia bernacchii and structural basis of the root effect

SCOP Domain Sequences for d1hbha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbha_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Antarctic fish (Pagothenia bernacchii)}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOP Domain Coordinates for d1hbha_:

Click to download the PDB-style file with coordinates for d1hbha_.
(The format of our PDB-style files is described here.)

Timeline for d1hbha_: