Lineage for d2z48a3 (2z48 A:284-432)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 881945Fold d.281: Hemolytic lectin CEL-III, C-terminal domain [111264] (1 superfamily)
    unusual fold
  4. 881946Superfamily d.281.1: Hemolytic lectin CEL-III, C-terminal domain [111265] (1 family) (S)
  5. 881947Family d.281.1.1: Hemolytic lectin CEL-III, C-terminal domain [111266] (1 protein)
  6. 881948Protein Hemolytic lectin CEL-III, C-terminal domain [111267] (1 species)
  7. 881949Species Cucumaria echinata [TaxId:40245] [111268] (3 PDB entries)
    Uniprot Q868M7 11-442
  8. 881952Domain d2z48a3: 2z48 A:284-432 [154038]
    Other proteins in same PDB: d2z48a1, d2z48a2, d2z48b1, d2z48b2
    automatically matched to d1vcla3
    complexed with a2g, ca, mg, nga

Details for d2z48a3

PDB Entry: 2z48 (more details), 1.7 Å

PDB Description: crystal structure of hemolytic lectin cel-iii complexed with galnac
PDB Compounds: (A:) hemolytic lectin CEL-III

SCOP Domain Sequences for d2z48a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z48a3 d.281.1.1 (A:284-432) Hemolytic lectin CEL-III, C-terminal domain {Cucumaria echinata [TaxId: 40245]}
ddwevptatwnmvgcdqngkvsqqisntisfsstvtagvavevsstiekgvifakatvsv
kvtaslskawtnsqsgttaitytcdnydsdeeftrgcmwqlaiettevksgdllvwnpqi
vkctrsntapgcapftkcanedctfctdi

SCOP Domain Coordinates for d2z48a3:

Click to download the PDB-style file with coordinates for d2z48a3.
(The format of our PDB-style files is described here.)

Timeline for d2z48a3: