SCOPe 2.06: Domain d2z46d_: 2z46 D:

Lineage for d2z46d_ (2z46 D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.280: RbcX-like [158614] (1 superfamily)
   5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer

4. Superfamily a.280.1: RbcX-like [158615] (2 families)

5. Family a.280.1.1: RbcX-like [158616] (1 protein)
   Pfam PF02341 (note typo in the Pfam name: RcbX)

6. Protein RuBisCo chaperone RbcX [158617] (5 species)

7. Species Synechococcus sp. [TaxId:32049] [255545] (4 PDB entries)

8. Domain d2z46d_: 2z46 D: [154033]
   automated match to d2pema1

Details for d2z46d_

PDB Entry: 2z46, 2.97 Å

PDB Description: Crystal Structure of Native-ORF134

PDB Compounds: (D:) orf134

SCOPe Domain Sequences for d2z46d_:

Sequence; same for both SEQRES and ATOM records:

>d2z46d_ a.280.1.1 (D:) RuBisCo chaperone RbcX {Synechococcus sp. [TaxId: 32049]}
mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerlt

Timeline for d2z46d_:

• d2z46d_ first appeared in SCOP 1.75, called d2z46d1
  
• d2z46d_ appears in SCOPe 2.05
  
• d2z46d_ appears in SCOPe 2.07
  
• d2z46d_ appears in the current release, SCOPe 2.08