SCOPe 2.04: Domain d2z46c_: 2z46 C:

Lineage for d2z46c_ (2z46 C:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.280: RbcX-like [158614] (1 superfamily)
   5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer

4. Superfamily a.280.1: RbcX-like [158615] (2 families)

5. Family a.280.1.1: RbcX-like [158616] (1 protein)
   Pfam PF02341 (note typo in the Pfam name: RcbX)

6. Protein RuBisCo chaperone RbcX [158617] (4 species)

7. Species Synechococcus sp. [TaxId:32049] [255545] (4 PDB entries)

8. Domain d2z46c_: 2z46 C: [154032]
   automated match to d2pema1

Details for d2z46c_

PDB Entry: 2z46, 2.97 Å

PDB Description: Crystal Structure of Native-ORF134

PDB Compounds: (C:) orf134

SCOPe Domain Sequences for d2z46c_:

Sequence; same for both SEQRES and ATOM records:

>d2z46c_ a.280.1.1 (C:) RuBisCo chaperone RbcX {Synechococcus sp. [TaxId: 32049]}
fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq

Timeline for d2z46c_:

• d2z46c_ first appeared in SCOP 1.75, called d2z46c1
  
• d2z46c_ appears in SCOPe 2.03
  
• d2z46c_ appears in SCOPe 2.05
  
• d2z46c_ appears in the current release, SCOPe 2.08