Lineage for d1pbxa_ (1pbx A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436191Protein Hemoglobin, alpha-chain [46486] (18 species)
  7. 436232Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (4 PDB entries)
  8. 436234Domain d1pbxa_: 1pbx A: [15403]
    Other proteins in same PDB: d1pbxb_

Details for d1pbxa_

PDB Entry: 1pbx (more details), 2.5 Å

PDB Description: haemoglobin of the antarctic fish pagothenia bernacchii: amino acid sequence, oxygen equilibria and crystal structure of its carbonmonoxy derivative

SCOP Domain Sequences for d1pbxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbxa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii)}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOP Domain Coordinates for d1pbxa_:

Click to download the PDB-style file with coordinates for d1pbxa_.
(The format of our PDB-style files is described here.)

Timeline for d1pbxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pbxb_