Lineage for d1pbxa_ (1pbx A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 208554Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 208555Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 208567Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 208672Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 208673Species Antarctic fish (Pagothenia bernacchii) [46495] (2 PDB entries)
  8. 208674Domain d1pbxa_: 1pbx A: [15403]
    Other proteins in same PDB: d1pbxb_
    complexed with hem

Details for d1pbxa_

PDB Entry: 1pbx (more details), 2.5 Å

PDB Description: haemoglobin of the antarctic fish pagothenia bernacchii: amino acid sequence, oxygen equilibria and crystal structure of its carbonmonoxy derivative

SCOP Domain Sequences for d1pbxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbxa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Antarctic fish (Pagothenia bernacchii)}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOP Domain Coordinates for d1pbxa_:

Click to download the PDB-style file with coordinates for d1pbxa_.
(The format of our PDB-style files is described here.)

Timeline for d1pbxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pbxb_