Lineage for d2z3ya1 (2z3y A:172-273)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1477566Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1478350Family a.4.1.18: SWIRM domain [140222] (4 proteins)
    Pfam PF04433; contains extra N-terminal helix
  6. 1478351Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species)
  7. 1478352Species Human (Homo sapiens) [TaxId:9606] [140228] (9 PDB entries)
    Uniprot O60341 169-279
  8. 1478354Domain d2z3ya1: 2z3y A:172-273 [154024]
    Other proteins in same PDB: d2z3ya2, d2z3ya3
    automatically matched to 2IW5 A:171-273
    complexed with f2n

Details for d2z3ya1

PDB Entry: 2z3y (more details), 2.25 Å

PDB Description: Crystal structure of Lysine-specific demethylase1
PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2z3ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z3ya1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl

SCOPe Domain Coordinates for d2z3ya1:

Click to download the PDB-style file with coordinates for d2z3ya1.
(The format of our PDB-style files is described here.)

Timeline for d2z3ya1: