SCOPe 2.05: Domain d2z3va_: 2z3v A:

Lineage for d2z3va_ (2z3v A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
   Pfam PF00582

6. Protein automated matches [190391] (3 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187254] (1 PDB entry)

8. Domain d2z3va_: 2z3v A: [154023]
   automated match to d1wjga_
   complexed with pgo

Details for d2z3va_

PDB Entry: 2z3v, 1.65 Å

PDB Description: crystal structure of uncharacterized conserved protein from thermus thermophilus hb8

PDB Compounds: (A:) Universal stress protein family

SCOPe Domain Sequences for d2z3va_:

Sequence; same for both SEQRES and ATOM records:

>d2z3va_ c.26.2.4 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mfktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrle
raegvleearaltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgs
qsqrvvaeapcpvllvr

Timeline for d2z3va_:

• d2z3va_ first appeared in SCOP 1.75, called d2z3va1
  
• d2z3va_ appears in SCOPe 2.04
  
• d2z3va_ appears in SCOPe 2.06
  
• d2z3va_ appears in the current release, SCOPe 2.08