![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) ![]() |
![]() | Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins) |
![]() | Protein Maurotoxin [57129] (2 species) |
![]() | Species Scorpio maurus palmatus [TaxId:53957] [161118] (1 PDB entry) |
![]() | Domain d2z3sa1: 2z3s A:6-39 [154022] automatically matched to d1txma_ |
PDB Entry: 2z3s (more details)
SCOPe Domain Sequences for d2z3sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z3sa1 g.3.7.2 (A:6-39) Maurotoxin {Scorpio maurus palmatus [TaxId: 53957]} vsctgskdcyapcrkqtgcpnakcinksckcygc
Timeline for d2z3sa1: