SCOP 1.63: Domain d1ouuc_: 1ouu C:

Lineage for d1ouuc_ (1ouu C:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (16 species)

7. Species Trout (Oncorhynchus mykiss) [TaxId:8022] [46494] (2 PDB entries)

8. Domain d1ouuc_: 1ouu C: [15402]
   Other proteins in same PDB: d1ouub_, d1ouud_
   complexed with ace, cmo, hem; mutant

Details for d1ouuc_

PDB Entry: 1ouu, 2.5 Å

PDB Description: carbonmonoxy trout hemoglobin i

SCOP Domain Sequences for d1ouuc_:

Sequence; same for both SEQRES and ATOM records:

>d1ouuc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Trout (Oncorhynchus mykiss)}
sltakdksvvkafwgkisgkadvvgaealgrmltaypqtktyfshwadlspgsgpvkkhg
giimgaigkavglmddlvggmsalsdlhafklrvdpgnfkilshnilvtlaihfpsdftp
evhiavdkflaavsaaladkyr

Timeline for d1ouuc_:

• d1ouuc_ first appeared (with stable ids) in SCOP 1.55
  
• d1ouuc_ appears in SCOP 1.61
  
• d1ouuc_ appears in SCOP 1.65
  
• d1ouuc_ appears in the current release, SCOPe 2.08