Lineage for d2z3rk2 (2z3r K:1-114)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705596Protein Interleukin-15 (IL-15) [158422] (2 species)
  7. 2705597Species Human (Homo sapiens) [TaxId:9606] [158423] (3 PDB entries)
    Uniprot P40933 49-162
  8. 2705605Domain d2z3rk2: 2z3r K:1-114 [154016]
    Other proteins in same PDB: d2z3ra3, d2z3rb2, d2z3rb3, d2z3rc3, d2z3rd2, d2z3rd3, d2z3re3, d2z3rf2, d2z3rf3, d2z3rg3, d2z3rh2, d2z3rh3, d2z3ri3, d2z3rj2, d2z3rj3, d2z3rk3, d2z3rl2, d2z3rl3, d2z3rm3, d2z3rn2, d2z3rn3, d2z3ro3, d2z3rp2, d2z3rp3
    automated match to d2z3qa1
    complexed with gol

Details for d2z3rk2

PDB Entry: 2z3r (more details), 2 Å

PDB Description: Crystal structure of the IL-15/IL-15Ra complex
PDB Compounds: (K:) Interleukin-15

SCOPe Domain Sequences for d2z3rk2:

Sequence, based on SEQRES records: (download)

>d2z3rk2 a.26.1.2 (K:1-114) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]}
nwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdasih
dtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfints

Sequence, based on observed residues (ATOM records): (download)

>d2z3rk2 a.26.1.2 (K:1-114) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]}
nwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdasih
dtvenliilannslssvtesgckeceeleeknikeflqsfvhivqmfints

SCOPe Domain Coordinates for d2z3rk2:

Click to download the PDB-style file with coordinates for d2z3rk2.
(The format of our PDB-style files is described here.)

Timeline for d2z3rk2: