Lineage for d2z3rj2 (2z3r J:1-73)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2585277Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2585278Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2585279Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 2585497Protein Interleukin-15 receptor subunit alpha [161139] (2 species)
  7. 2585498Species Human (Homo sapiens) [TaxId:9606] [161141] (4 PDB entries)
    Uniprot Q13261 31-108! Uniprot Q13261 31-96
  8. 2585505Domain d2z3rj2: 2z3r J:1-73 [154015]
    Other proteins in same PDB: d2z3ra2, d2z3ra3, d2z3rb3, d2z3rc2, d2z3rc3, d2z3rd3, d2z3re2, d2z3re3, d2z3rf3, d2z3rg2, d2z3rg3, d2z3rh3, d2z3ri2, d2z3ri3, d2z3rj3, d2z3rk2, d2z3rk3, d2z3rl3, d2z3rm2, d2z3rm3, d2z3rn3, d2z3ro2, d2z3ro3, d2z3rp3
    automated match to d2z3qb1
    complexed with gol

Details for d2z3rj2

PDB Entry: 2z3r (more details), 2 Å

PDB Description: Crystal structure of the IL-15/IL-15Ra complex
PDB Compounds: (J:) Interleukin-15 receptor alpha chain

SCOPe Domain Sequences for d2z3rj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z3rj2 g.18.1.1 (J:1-73) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]}
itcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttps
lkcirdpalvhqr

SCOPe Domain Coordinates for d2z3rj2:

Click to download the PDB-style file with coordinates for d2z3rj2.
(The format of our PDB-style files is described here.)

Timeline for d2z3rj2: