![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (24 species) |
![]() | Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [46494] (2 PDB entries) |
![]() | Domain d1ouua_: 1ouu A: [15401] Other proteins in same PDB: d1ouub_, d1ouud_ complexed with cmo, hem |
PDB Entry: 1ouu (more details), 2.5 Å
SCOPe Domain Sequences for d1ouua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ouua_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]} sltakdksvvkafwgkisgkadvvgaealgrmltaypqtktyfshwadlspgsgpvkkhg giimgaigkavglmddlvggmsalsdlhafklrvdpgnfkilshnilvtlaihfpsdftp evhiavdkflaavsaaladkyr
Timeline for d1ouua_: