![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
![]() | Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) ![]() |
![]() | Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
![]() | Protein Interleukin-15 receptor subunit alpha [161139] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [161141] (4 PDB entries) Uniprot Q13261 31-108! Uniprot Q13261 31-96 |
![]() | Domain d2z3rd2: 2z3r D:1-72 [154009] Other proteins in same PDB: d2z3ra2, d2z3ra3, d2z3rb3, d2z3rc2, d2z3rc3, d2z3rd3, d2z3re2, d2z3re3, d2z3rf3, d2z3rg2, d2z3rg3, d2z3rh3, d2z3ri2, d2z3ri3, d2z3rj3, d2z3rk2, d2z3rk3, d2z3rl3, d2z3rm2, d2z3rm3, d2z3rn3, d2z3ro2, d2z3ro3, d2z3rp3 automated match to d2z3qb1 complexed with gol |
PDB Entry: 2z3r (more details), 2 Å
SCOPe Domain Sequences for d2z3rd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z3rd2 g.18.1.1 (D:1-72) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} itcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttps lkcirdpalvhq
Timeline for d2z3rd2:
![]() Domains from other chains: (mouse over for more information) d2z3ra2, d2z3ra3, d2z3rb2, d2z3rb3, d2z3rc2, d2z3rc3, d2z3re2, d2z3re3, d2z3rf2, d2z3rf3, d2z3rg2, d2z3rg3, d2z3rh2, d2z3rh3, d2z3ri2, d2z3ri3, d2z3rj2, d2z3rj3, d2z3rk2, d2z3rk3, d2z3rl2, d2z3rl3, d2z3rm2, d2z3rm3, d2z3rn2, d2z3rn3, d2z3ro2, d2z3ro3, d2z3rp2, d2z3rp3 |