Class a: All alpha proteins [46456] (289 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein Interleukin-15 (IL-15) [158422] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [158423] (3 PDB entries) Uniprot P40933 49-162 |
Domain d2z3ra2: 2z3r A:1-112 [154006] Other proteins in same PDB: d2z3ra3, d2z3rb2, d2z3rb3, d2z3rc3, d2z3rd2, d2z3rd3, d2z3re3, d2z3rf2, d2z3rf3, d2z3rg3, d2z3rh2, d2z3rh3, d2z3ri3, d2z3rj2, d2z3rj3, d2z3rk3, d2z3rl2, d2z3rl3, d2z3rm3, d2z3rn2, d2z3rn3, d2z3ro3, d2z3rp2, d2z3rp3 automated match to d2z3qa1 complexed with gol |
PDB Entry: 2z3r (more details), 2 Å
SCOPe Domain Sequences for d2z3ra2:
Sequence, based on SEQRES records: (download)
>d2z3ra2 a.26.1.2 (A:1-112) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]} nwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdasih dtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfin
>d2z3ra2 a.26.1.2 (A:1-112) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]} nwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdasih dtvenliilannslsstesgckeceeleeknikeflqsfvhivqmfin
Timeline for d2z3ra2:
View in 3D Domains from other chains: (mouse over for more information) d2z3rb2, d2z3rb3, d2z3rc2, d2z3rc3, d2z3rd2, d2z3rd3, d2z3re2, d2z3re3, d2z3rf2, d2z3rf3, d2z3rg2, d2z3rg3, d2z3rh2, d2z3rh3, d2z3ri2, d2z3ri3, d2z3rj2, d2z3rj3, d2z3rk2, d2z3rk3, d2z3rl2, d2z3rl3, d2z3rm2, d2z3rm3, d2z3rn2, d2z3rn3, d2z3ro2, d2z3ro3, d2z3rp2, d2z3rp3 |