SCOPe 2.06: Domain d2z3ra2: 2z3r A:1-112

Lineage for d2z3ra2 (2z3r A:1-112)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-15 (IL-15) [158422] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158423] (3 PDB entries)
   Uniprot P40933 49-162

8. Domain d2z3ra2: 2z3r A:1-112 [154006]
   Other proteins in same PDB: d2z3ra3, d2z3rb2, d2z3rb3, d2z3rc3, d2z3rd2, d2z3rd3, d2z3re3, d2z3rf2, d2z3rf3, d2z3rg3, d2z3rh2, d2z3rh3, d2z3ri3, d2z3rj2, d2z3rj3, d2z3rk3, d2z3rl2, d2z3rl3, d2z3rm3, d2z3rn2, d2z3rn3, d2z3ro3, d2z3rp2, d2z3rp3
   automated match to d2z3qa1
   complexed with gol

Details for d2z3ra2

PDB Entry: 2z3r, 2 Å

PDB Description: Crystal structure of the IL-15/IL-15Ra complex

PDB Compounds: (A:) Interleukin-15

SCOPe Domain Sequences for d2z3ra2:

Sequence, based on SEQRES records:

>d2z3ra2 a.26.1.2 (A:1-112) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]}
nwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdasih
dtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfin

Sequence, based on observed residues (ATOM records):

>d2z3ra2 a.26.1.2 (A:1-112) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]}
nwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdasih
dtvenliilannslsstesgckeceeleeknikeflqsfvhivqmfin

Timeline for d2z3ra2:

• d2z3ra2 first appeared in SCOP 1.75, called d2z3ra1
  
• d2z3ra2 was called d2z3ra_ in SCOPe 2.05
  
• d2z3ra2 appears in SCOPe 2.07
  
• d2z3ra2 appears in the current release, SCOPe 2.08