![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
![]() | Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) ![]() |
![]() | Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
![]() | Protein Interleukin-15 receptor subunit alpha [161139] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [161141] (4 PDB entries) Uniprot Q13261 31-108! Uniprot Q13261 31-96 |
![]() | Domain d2z3qd2: 2z3q D:1-73 [154005] Other proteins in same PDB: d2z3qa1, d2z3qa2, d2z3qb2, d2z3qc2, d2z3qc3, d2z3qd3 automated match to d2z3qb1 |
PDB Entry: 2z3q (more details), 1.85 Å
SCOPe Domain Sequences for d2z3qd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z3qd2 g.18.1.1 (D:1-73) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} itcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttps lkcirdpalvhqr
Timeline for d2z3qd2: