Lineage for d2z3qb1 (2z3q B:1-78)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260769Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2260770Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2260771Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 2260989Protein Interleukin-15 receptor subunit alpha [161139] (2 species)
  7. 2260990Species Human (Homo sapiens) [TaxId:9606] [161141] (4 PDB entries)
    Uniprot Q13261 31-108! Uniprot Q13261 31-96
  8. 2260991Domain d2z3qb1: 2z3q B:1-78 [154003]
    Other proteins in same PDB: d2z3qa1, d2z3qa2, d2z3qb2, d2z3qc2, d2z3qc3, d2z3qd3

Details for d2z3qb1

PDB Entry: 2z3q (more details), 1.85 Å

PDB Description: Crystal structure of the IL-15/IL-15Ra complex
PDB Compounds: (B:) Interleukin-15 receptor alpha chain

SCOPe Domain Sequences for d2z3qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]}
itcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttps
lkcirdpalvhqrpapps

SCOPe Domain Coordinates for d2z3qb1:

Click to download the PDB-style file with coordinates for d2z3qb1.
(The format of our PDB-style files is described here.)

Timeline for d2z3qb1: