Lineage for d2z3qa1 (2z3q A:1-114)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991436Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1991437Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1991528Family a.26.1.2: Short-chain cytokines [47286] (14 protein domains)
  6. 1991569Protein Interleukin-15 (IL-15) [158422] (2 species)
  7. 1991570Species Human (Homo sapiens) [TaxId:9606] [158423] (3 PDB entries)
    Uniprot P40933 49-162
  8. 1991571Domain d2z3qa1: 2z3q A:1-114 [154002]
    Other proteins in same PDB: d2z3qa2, d2z3qb1, d2z3qb2, d2z3qc3, d2z3qd2, d2z3qd3

Details for d2z3qa1

PDB Entry: 2z3q (more details), 1.85 Å

PDB Description: Crystal structure of the IL-15/IL-15Ra complex
PDB Compounds: (A:) Interleukin-15

SCOPe Domain Sequences for d2z3qa1:

Sequence, based on SEQRES records: (download)

>d2z3qa1 a.26.1.2 (A:1-114) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]}
nwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdasih
dtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfints

Sequence, based on observed residues (ATOM records): (download)

>d2z3qa1 a.26.1.2 (A:1-114) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]}
nwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdasih
dtvenliilannslstesgckeceeleeknikeflqsfvhivqmfints

SCOPe Domain Coordinates for d2z3qa1:

Click to download the PDB-style file with coordinates for d2z3qa1.
(The format of our PDB-style files is described here.)

Timeline for d2z3qa1: