Lineage for d2z3fd1 (2z3f D:2-161)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766651Superfamily b.1.22: ASF1-like [101546] (2 families) (S)
    contains extra C-terminal strand
    automatically mapped to Pfam PF04729
  5. 2766652Family b.1.22.1: ASF1-like [101547] (2 proteins)
  6. 2766653Protein Anti-silencing protein 1, ASF1 [101548] (3 species)
  7. 2766658Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [158909] (4 PDB entries)
    Uniprot O74515 1-161
  8. 2766667Domain d2z3fd1: 2z3f D:2-161 [153989]
    automatically matched to 2CU9 A:1-161

Details for d2z3fd1

PDB Entry: 2z3f (more details), 2.7 Å

PDB Description: crystal structure of spcia1/asf1 complexed with cac2 peptide
PDB Compounds: (D:) Histone chaperone cia1

SCOPe Domain Sequences for d2z3fd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z3fd1 b.1.22.1 (D:2-161) Anti-silencing protein 1, ASF1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
sivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtll
vgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemegl
nlqemddaeikkvkvdiskvwrsilaekprvtrfniqwdn

SCOPe Domain Coordinates for d2z3fd1:

Click to download the PDB-style file with coordinates for d2z3fd1.
(The format of our PDB-style files is described here.)

Timeline for d2z3fd1: