SCOPe 2.04: Domain d2z3fa1: 2z3f A:2-161

Lineage for d2z3fa1 (2z3f A:2-161)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.22: ASF1-like [101546] (1 family)
   contains extra C-terminal strand
   automatically mapped to Pfam PF04729

5. Family b.1.22.1: ASF1-like [101547] (2 proteins)

6. Protein Anti-silencing protein 1, ASF1 [101548] (3 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [158909] (4 PDB entries)
   Uniprot O74515 1-161

8. Domain d2z3fa1: 2z3f A:2-161 [153986]
   automatically matched to 2CU9 A:1-161

Details for d2z3fa1

PDB Entry: 2z3f, 2.7 Å

PDB Description: crystal structure of spcia1/asf1 complexed with cac2 peptide

PDB Compounds: (A:) Histone chaperone cia1

SCOPe Domain Sequences for d2z3fa1:

Sequence; same for both SEQRES and ATOM records:

>d2z3fa1 b.1.22.1 (A:2-161) Anti-silencing protein 1, ASF1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
sivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtll
vgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemegl
nlqemddaeikkvkvdiskvwrsilaekprvtrfniqwdn

Timeline for d2z3fa1:

• d2z3fa1 first appeared in SCOP 1.75
  
• d2z3fa1 appears in SCOPe 2.03
  
• d2z3fa1 appears in SCOPe 2.05
  
• d2z3fa1 appears in the current release, SCOPe 2.08