Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.22: ASF1-like [101546] (2 families) contains extra C-terminal strand automatically mapped to Pfam PF04729 |
Family b.1.22.1: ASF1-like [101547] (2 proteins) |
Protein Anti-silencing protein 1, ASF1 [101548] (3 species) |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [158909] (4 PDB entries) Uniprot O74515 1-161 |
Domain d2z3fa1: 2z3f A:2-161 [153986] automatically matched to 2CU9 A:1-161 |
PDB Entry: 2z3f (more details), 2.7 Å
SCOPe Domain Sequences for d2z3fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z3fa1 b.1.22.1 (A:2-161) Anti-silencing protein 1, ASF1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} sivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtll vgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemegl nlqemddaeikkvkvdiskvwrsilaekprvtrfniqwdn
Timeline for d2z3fa1: