Lineage for d1hv4e_ (1hv4 E:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 93559Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 93564Species Bar-headed goose (Anser indicus) [TaxId:8846] [46493] (3 PDB entries)
  8. 93569Domain d1hv4e_: 1hv4 E: [15398]
    Other proteins in same PDB: d1hv4b_, d1hv4d_, d1hv4f_, d1hv4h_

Details for d1hv4e_

PDB Entry: 1hv4 (more details), 2.8 Å

PDB Description: crystal structure analysis of bar-head goose hemoglobin (deoxy form)

SCOP Domain Sequences for d1hv4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv4e_ a.1.1.2 (E:) Hemoglobin, alpha-chain {Bar-headed goose (Anser indicus)}
vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
kvvaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltae
vhasldkflcavgtvltakyr

SCOP Domain Coordinates for d1hv4e_:

Click to download the PDB-style file with coordinates for d1hv4e_.
(The format of our PDB-style files is described here.)

Timeline for d1hv4e_: