Lineage for d2z3bh_ (2z3b H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993320Species Bacillus subtilis [TaxId:1423] [187296] (1 PDB entry)
  8. 2993328Domain d2z3bh_: 2z3b H: [153978]
    automated match to d1m4ya_
    complexed with na

Details for d2z3bh_

PDB Entry: 2z3b (more details), 2.5 Å

PDB Description: crystal structure of bacillus subtilis codw, a non-canonical hslv-like peptidase with an impaired catalytic apparatus
PDB Compounds: (H:) ATP-dependent protease hslv

SCOPe Domain Sequences for d2z3bh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z3bh_ d.153.1.4 (H:) automated matches {Bacillus subtilis [TaxId: 1423]}
ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele

SCOPe Domain Coordinates for d2z3bh_:

Click to download the PDB-style file with coordinates for d2z3bh_.
(The format of our PDB-style files is described here.)

Timeline for d2z3bh_: