Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
Protein HslV (ClpQ) protease [56258] (4 species) dodecameric prokaryotic homologue of proteasome |
Species Bacillus subtilis [TaxId:1423] [160845] (3 PDB entries) Uniprot P39070 2-181 |
Domain d2z3bf1: 2z3b F:1-180 [153976] automatically matched to 1YYF C:2-181 complexed with na |
PDB Entry: 2z3b (more details), 2.5 Å
SCOP Domain Sequences for d2z3bf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z3bf1 d.153.1.4 (F:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
Timeline for d2z3bf1: