Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [187296] (1 PDB entry) |
Domain d2z3bf_: 2z3b F: [153976] automated match to d1m4ya_ complexed with na |
PDB Entry: 2z3b (more details), 2.5 Å
SCOPe Domain Sequences for d2z3bf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z3bf_ d.153.1.4 (F:) automated matches {Bacillus subtilis [TaxId: 1423]} ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
Timeline for d2z3bf_: