Lineage for d2z3ai1 (2z3a I:1-180)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222781Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1222782Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 1222783Species Bacillus subtilis [TaxId:1423] [160845] (2 PDB entries)
    Uniprot P39070 2-181
  8. 1222792Domain d2z3ai1: 2z3a I:1-180 [153967]
    automatically matched to 1YYF C:2-181

Details for d2z3ai1

PDB Entry: 2z3a (more details), 3 Å

PDB Description: crystal structure of bacillus subtilis codw, a non-canonical hslv-like peptidase with an impaired catalytic apparatus
PDB Compounds: (I:) ATP-dependent protease hslv

SCOPe Domain Sequences for d2z3ai1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z3ai1 d.153.1.4 (I:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]}
ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele

SCOPe Domain Coordinates for d2z3ai1:

Click to download the PDB-style file with coordinates for d2z3ai1.
(The format of our PDB-style files is described here.)

Timeline for d2z3ai1: