Lineage for d2z3ah_ (2z3a H:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1934575Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 1934576Species Bacillus subtilis [TaxId:1423] [160845] (2 PDB entries)
    Uniprot P39070 2-181
  8. 1934584Domain d2z3ah_: 2z3a H: [153966]
    automated match to d2z3ad1

Details for d2z3ah_

PDB Entry: 2z3a (more details), 3 Å

PDB Description: crystal structure of bacillus subtilis codw, a non-canonical hslv-like peptidase with an impaired catalytic apparatus
PDB Compounds: (H:) ATP-dependent protease hslv

SCOPe Domain Sequences for d2z3ah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z3ah_ d.153.1.4 (H:) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]}
ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele

SCOPe Domain Coordinates for d2z3ah_:

Click to download the PDB-style file with coordinates for d2z3ah_.
(The format of our PDB-style files is described here.)

Timeline for d2z3ah_: