![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein HslV (ClpQ) protease [56258] (4 species) dodecameric prokaryotic homologue of proteasome |
![]() | Species Bacillus subtilis [TaxId:1423] [160845] (2 PDB entries) Uniprot P39070 2-181 |
![]() | Domain d2z3ae_: 2z3a E: [153963] automated match to d2z3ad1 |
PDB Entry: 2z3a (more details), 3 Å
SCOPe Domain Sequences for d2z3ae_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z3ae_ d.153.1.4 (E:) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
Timeline for d2z3ae_: