Lineage for d1hv4a_ (1hv4 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1976766Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 1976783Species Bar-headed goose (Anser indicus) [TaxId:8846] [46493] (4 PDB entries)
  8. 1976787Domain d1hv4a_: 1hv4 A: [15396]
    Other proteins in same PDB: d1hv4b_, d1hv4d_, d1hv4f_, d1hv4h_
    complexed with hem

Details for d1hv4a_

PDB Entry: 1hv4 (more details), 2.8 Å

PDB Description: crystal structure analysis of bar-head goose hemoglobin (deoxy form)
PDB Compounds: (A:) hemoglobin alpha-a chain

SCOPe Domain Sequences for d1hv4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv4a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]}
vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
kvvaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltae
vhasldkflcavgtvltakyr

SCOPe Domain Coordinates for d1hv4a_:

Click to download the PDB-style file with coordinates for d1hv4a_.
(The format of our PDB-style files is described here.)

Timeline for d1hv4a_: