SCOPe 2.01: Domain d2z34b1: 2z34 B:2-160

Lineage for d2z34b1 (2z34 B:2-160)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.22: ASF1-like [101546] (1 family)
   contains extra C-terminal strand

5. Family b.1.22.1: ASF1-like [101547] (1 protein)

6. Protein Anti-silencing protein 1, ASF1 [101548] (3 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [158909] (4 PDB entries)
   Uniprot O74515 1-161

8. Domain d2z34b1: 2z34 B:2-160 [153958]
   automatically matched to 2CU9 A:1-161

Details for d2z34b1

PDB Entry: 2z34, 2.4 Å

PDB Description: Crystal structure of SpCia1/Asf1 complex with Hip1

PDB Compounds: (B:) Histone chaperone cia1

SCOPe Domain Sequences for d2z34b1:

Sequence, based on SEQRES records:

>d2z34b1 b.1.22.1 (B:2-160) Anti-silencing protein 1, ASF1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
sivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtll
vgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemegl
nlqemddaeikkvkvdiskvwrsilaekprvtrfniqwd

Sequence, based on observed residues (ATOM records):

>d2z34b1 b.1.22.1 (B:2-160) Anti-silencing protein 1, ASF1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
sivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtll
vgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemeei
kkvkvdiskvwrsilaekprvtrfniqwd

Timeline for d2z34b1:

• d2z34b1 first appeared in SCOP 1.75
  
• d2z34b1 appears in SCOPe 2.02
  
• d2z34b1 appears in the current release, SCOPe 2.08