SCOPe 2.05: Domain d2z33a_: 2z33 A:

Lineage for d2z33a_ (2z33 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.1: PhoB-like [46895] (5 proteins)
   contains 4-stranded meander beta-sheet in the N-terminal extension

6. Protein PhoB [46898] (2 species)

7. Species Escherichia coli [TaxId:562] [46899] (4 PDB entries)

8. Domain d2z33a_: 2z33 A: [153956]
   automated match to d2z33a1
   protein/DNA complex

Details for d2z33a_

PDB Entry: 2z33

PDB Description: solution structure of the dna complex of phob dna- binding/transactivation domain

PDB Compounds: (A:) phosphate regulon transcriptional regulatory protein phob

SCOPe Domain Sequences for d2z33a_:

Sequence; same for both SEQRES and ATOM records:

>d2z33a_ a.4.6.1 (A:) PhoB {Escherichia coli [TaxId: 562]}
maveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvwg
tnvyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf

Timeline for d2z33a_:

• d2z33a_ first appeared in SCOP 1.75, called d2z33a1
  
• d2z33a_ appears in SCOPe 2.04
  
• d2z33a_ appears in SCOPe 2.06
  
• d2z33a_ appears in the current release, SCOPe 2.08